DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and prss60.3

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_002662541.2 Gene:prss60.3 / 335152 ZFINID:ZDB-GENE-030131-7092 Length:330 Species:Danio rerio


Alignment Length:289 Identity:86/289 - (29%)
Similarity:134/289 - (46%) Gaps:46/289 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWTTLWTVLLLLLCGVQVILGQ-DVAQNQSESAIEPRIVGGIKAKQGQFPHQISLR--LRGEHYC 62
            ||......|.||:| |:..|.| :|.   .::.:..|||||:.|..|.:|.|:||.  ..|.|:|
Zfish     3 MWRLTCATLTLLIC-VKGSLSQLNVC---GQAPLNTRIVGGVNASPGSWPWQVSLHSPKYGGHFC 63

  Fly    63 GGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLL-----SSDGVRI-----PVAEVIMHPN 117
            ||.:||:..|:||.||           |..:...:|::     :..|:.|     .||:..:|.:
Zfish    64 GGSLISSEWVLTAAHC-----------LSGVSETTLVVYLGRRTQQGINIYETSRNVAKSFVHSS 117

  Fly   118 Y-ATGGHNDLAVLRLQSPLTFDANIAAIQLATEDPPNCVAVD--ISGWG------NIAEKGPLSD 173
            | :....||:|:|||.|.:||...|..:.||.::........  |:|||      |:...|.|.:
Zfish   118 YNSNTNDNDIALLRLSSAVTFTNYIRPVCLAAQNSVYSAGTSSWITGWGDIQAGVNLPAPGILQE 182

  Fly   174 SLLFVQVTSISRGACRWMFYS-RLPETMICL-LHSKNSGACYGDSGGPATYGGKVVGLASLLLGG 236
            :::.|    ::...|..:..| .:...|||. |.......|.||||||.......|.:.:.:...
Zfish   183 TMIPV----VANDRCNALLGSGTVTNNMICAGLTQGGKDTCQGDSGGPMVTRLCTVWVQAGITSW 243

  Fly   237 GCGRAAPDG---YLRISKVRAWIAEKAGL 262
            |.|.|.|:.   |.|:|:.::||:.|..|
Zfish   244 GYGCADPNSPGVYTRVSQYQSWISSKISL 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 72/245 (29%)
Tryp_SPc 37..219 CDD:238113 61/204 (30%)
prss60.3XP_002662541.2 Tryp_SPc 36..269 CDD:238113 73/247 (30%)
Somatomedin_B 294..328 CDD:321959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587854
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.