DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG3117

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster


Alignment Length:268 Identity:70/268 - (26%)
Similarity:109/268 - (40%) Gaps:76/268 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVK--HGNDVVPADLWSIQAGS 97
            |::.|. :.|..|||...:|..:|.:..||.:|:...|:||.|.:.  ..||::      ::||.
  Fly    91 PQVFGD-QTKPNQFPWVTALFAKGSYLGGGSLITPGLVLTAAHILAGLSPNDIM------VRAGE 148

  Fly    98 LLLSSDGVRIP-----VAEVIMHP--NYATGGHNDLAVLRLQSPLTFDANIAAIQL----ATEDP 151
            ..|||.....|     |.:::.|.  ||::|. ||||:|.|.||....|||..|:|    .|.|.
  Fly   149 WDLSSSEKLNPPMDRQVIKIMEHEAFNYSSGA-NDLALLFLDSPFELRANIQTIRLPIPDKTFDR 212

  Fly   152 PNCVAVDISGWG----------NIAEKGPLSDSLLFVQVTSISRGACRWMF--------YSRLPE 198
            ..|.   ::|||          .|.:|         |.:..:....|:...        | :||.
  Fly   213 RICT---VAGWGMRSSTDVDIQTIQQK---------VDLPVVESSKCQRQLRLTKMGSNY-QLPA 264

  Fly   199 TMICLLHSKNSGACYGDSGGPATYGG--------------KVVGLASLLLGGGCGRA-APDGYLR 248
            :::|....:....|       :.:||              :..|:.|  .|.|||:| .|..:..
  Fly   265 SLMCAGGEEGRDVC-------SLFGGFALFCSLDDDPNRYEQAGIVS--FGVGCGQANVPTTFTH 320

  Fly   249 ISKVRAWI 256
            :||...||
  Fly   321 VSKFMEWI 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 67/265 (25%)
Tryp_SPc 37..219 CDD:238113 55/212 (26%)
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 69/264 (26%)
Tryp_SPc 95..328 CDD:214473 67/262 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457607
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.