DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG4271

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster


Alignment Length:231 Identity:73/231 - (31%)
Similarity:110/231 - (47%) Gaps:21/231 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLS 101
            |..|::||...:....|:.:.|.|.|||.:|.:..|:||..|||:    .|....:::.|:..:.
  Fly    19 IYNGVEAKFDFWTFLASVWVSGYHECGGAVIDSRIVLTAAQCVKN----KPVKRITVRVGTPDIY 79

  Fly   102 SDGVRIPVAEVIMHPNYATGGHNDLAVLRLQSPLTFDANIAAIQLATEDPPNCVAVDISGWGNIA 166
            ..|..|.|..:::|.|| ....||:|:|.|:.|: ....:..|.|||::|........:|||   
  Fly    80 RGGRIIRVTALVVHENY-KNWDNDIALLWLEKPV-LSVRVTKIPLATKEPSENEYPSNAGWG--- 139

  Fly   167 EKGPLSDSLLFVQ-----VTSI-SRGACRWMFYSRLPETMICLLHSKNSGACYGDSGGPATYGGK 225
            ||  |.:|.:..:     ||.| .|..|.......:.|.::|..:::|. .|.||.|||.....|
  Fly   140 EK--LLESYVVTRKLQNGVTKIRPRSMCAEELVEPVGEELLCAFYTEND-ICPGDYGGPLVLANK 201

  Fly   226 VVGLASLLLGGGCGRAA-PDGYLRISKVRAWIAEKA 260
            |||:|  :.|.|||.|. |..|..:.....||.|.|
  Fly   202 VVGIA--VQGHGCGFAVLPSLYTNVFHYLEWIEENA 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 69/225 (31%)
Tryp_SPc 37..219 CDD:238113 55/187 (29%)
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 71/228 (31%)
Tryp_SPc 19..231 CDD:214473 69/225 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004525
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.