DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG4259

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster


Alignment Length:235 Identity:58/235 - (24%)
Similarity:87/235 - (37%) Gaps:59/235 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 FPHQISLRLRGE---HYCG-GVIISATHVITAGHCVKHGNDVVPADLWSIQAG----SLLLSSDG 104
            ||..:|:..:.:   .|.| |.:|:...|:||.|.:   |.....|| .::||    |.......
  Fly    39 FPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHIL---NGTTKYDL-VVRAGEWDTSTTADQQH 99

  Fly   105 VRIPVAEVIMHPNY-ATGGHNDLAVLRLQSPLTFDANIAAIQLATED----PPNCVAVDISGWGN 164
            |.:.|..::.|..: .....|::|:|.|.|.....|||..|.|..::    ..:|.   .:|||.
  Fly   100 VDLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAGIQKGSCF---FNGWGK 161

  Fly   165 I-AEKGPLSDSLLFVQVTSISRGACRWMFYSRLPETMICLLHSKNSGA----CYGDSGGP----- 219
            : .........|..|||..:|.|.|.   ..:||...||     ..|.    |.||.|.|     
  Fly   162 VYLNSTDYPTVLKTVQVDLLSMGMCS---SRKLPIQQIC-----GKGLEGIDCSGDGGAPLVCRI 218

  Fly   220 ATYGGKVVGLASLLLGGGCGRAAPDGYLRISKVRAWIAEK 259
            .||                    |..|.::..|. |:::|
  Fly   219 LTY--------------------PYKYAQVGIVN-WLSQK 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 56/230 (24%)
Tryp_SPc 37..219 CDD:238113 50/188 (27%)
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 58/235 (25%)
Tryp_SPc 39..256 CDD:214473 58/235 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457565
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.