DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG11911

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster


Alignment Length:257 Identity:64/257 - (24%)
Similarity:102/257 - (39%) Gaps:64/257 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IVGGIKAKQGQFPHQISLR---LRGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSL 98
            ::.|.:|:....|:.:||.   |:..|.|||.:|:...::||.||:            |...|..
  Fly    37 VINGTEAEPHSAPYIVSLATNYLKHSHICGGTLINKDWIVTAAHCI------------SEPVGMS 89

  Fly    99 LLSSDGVRIPVAEVI---------MHPNYATG-GHNDLAVLRLQSPLTFDANIAAIQLATEDPPN 153
            :::....|..|.|:.         :|..|..| |..|:|:|.:.....|:..:....|.:.:..:
  Fly    90 IIAGLHTRAEVDELTQQRQVDFGRVHEKYTGGVGPYDIALLHVNESFIFNEWVQPATLPSREQVH 154

  Fly   154 CVAVDISGWGNIAEKGPLS------DSLLFVQVTSISRGACRWMFYSRLPETM------IC---L 203
            .....:.|||.     |.|      .:|..|....::...|:    ..|||:.      ||   |
  Fly   155 EGETHLYGWGQ-----PKSYIFSGAKTLQTVTTQILNYEECK----EELPESAPIAESNICSSSL 210

  Fly   204 LHSKNSGACYGDSGGP-----ATYGGKVVGLASLLLGGG---CGRA-APDGYLRISKVRAWI 256
            ..||:  ||.||||||     .....:::|:.|    .|   ||.| .|..|.::|....||
  Fly   211 QQSKS--ACNGDSGGPLVVEFTNAPSELIGIVS----WGYIPCGLANMPSIYTKVSAYIDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 62/255 (24%)
Tryp_SPc 37..219 CDD:238113 51/209 (24%)
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 64/257 (25%)
Tryp_SPc 37..266 CDD:214473 62/255 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.