DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG11912

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster


Alignment Length:265 Identity:69/265 - (26%)
Similarity:113/265 - (42%) Gaps:47/265 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SESAI--------EPRIVGGIKAKQGQFPHQISLR-LRGEHYCGGVIISATHVITAGHCVKHGND 84
            |.|||        |.||:.|.:|.:|:.|:.:||: ....|:|.|.::....::||.||:.:...
  Fly    14 SVSAISVPQPGFPEGRIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDEVTIVTAAHCLTYNQG 78

  Fly    85 VVPADLWSIQAGSLLLSSDGVRIPV-----AEVIMHPNYATG-GHNDLAVLRLQSPLTFDANIAA 143
            ...|...|        .:|...:.:     |:.::|.||..| |.||:.::.|:....||.|  |
  Fly    79 QAVAGAHS--------RTDQENVQIRKFTNAQYVIHENYGGGVGPNDIGLILLKEEDAFDLN--A 133

  Fly   144 IQLATEDPPNCVAVD-----------ISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMFYSR-- 195
            :.....:|.:.|::.           :.|||. ...|.|..:|..:....:....|:....|.  
  Fly   134 VARDGSNPVSAVSLPSKTFQGTSDGYLYGWGR-DNSGLLPLNLQKLDAIIVDYNECKAALPSNNS 197

  Fly   196 LPETMICLLHS--KNSGACYGDSGGP-----ATYGGKVVGLASLLLGGGCGRAAPDGYLRISKVR 253
            |.||.:| .|:  |..|:|.||||||     ::.|.:::|:.|...........|..|..:|...
  Fly   198 LAETNVC-THTPGKADGSCNGDSGGPLVSQSSSRGAELIGIVSWGYTPCLSTTYPSVYTSVSSFL 261

  Fly   254 AWIAE 258
            .||.|
  Fly   262 PWIDE 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 61/246 (25%)
Tryp_SPc 37..219 CDD:238113 52/203 (26%)
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 61/246 (25%)
Tryp_SPc 30..267 CDD:238113 63/249 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.