DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Prss53

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001074737.1 Gene:Prss53 / 330657 MGIID:2652890 Length:552 Species:Mus musculus


Alignment Length:241 Identity:71/241 - (29%)
Similarity:109/241 - (45%) Gaps:45/241 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WTVLLLLLCGVQVILGQDVAQ----NQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVI 66
            |...||::..|.||.|...||    .:.....||:....:   .|::|.|.|:|.:|.|.|.|.:
Mouse     5 WRPELLIVGAVVVIEGLQAAQRACGQRGPGPPEPQEGNTL---PGEWPWQASVRRQGVHICSGSL 66

  Fly    67 ISATHVITAGHCVKHGNDVVPADL--WSIQAGSLLLSSDGVRIPVAEVI---------MHPNYAT 120
            ::.|.|:||.||.:   .:..|:|  ||:..||  |..:| :.|.||.:         .:.:|:.
Mouse    67 VADTWVLTAAHCFE---KMATAELSSWSVVLGS--LKQEG-QSPGAEEVGVAALQLPKAYNHYSQ 125

  Fly   121 GGHNDLAVLRLQSPLTFDANIAAIQLATEDP--PNCVAVDISGWGNIAEKGPLSDSLLFVQVTSI 183
            |  :|||:|:|..| |....:...|.....|  .:|.|   :||..  ....:|.:|..:::..|
Mouse   126 G--SDLALLQLTHP-TVQTTLCLPQPTYHFPFGASCWA---TGWDQ--NTSDVSRTLRNLRLRLI 182

  Fly   184 SRGACRWMFYSRLPET---------MIC-LLHSKNSGACYGDSGGP 219
            ||..|..: |:||.:.         |:| .......|.|.||||||
Mouse   183 SRPTCNCL-YNRLHQRLLSNPARPGMLCGGAQPGEQGPCQGDSGGP 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 60/207 (29%)
Tryp_SPc 37..219 CDD:238113 58/204 (28%)
Prss53NP_001074737.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..46 2/21 (10%)
Tryp_SPc 45..271 CDD:238113 60/198 (30%)
Tryp_SPc 311..522 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.