DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP008276

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_555189.1 Gene:AgaP_AGAP008276 / 3291691 VectorBaseID:AGAP008276 Length:272 Species:Anopheles gambiae


Alignment Length:266 Identity:77/266 - (28%)
Similarity:123/266 - (46%) Gaps:33/266 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLLLLLCGVQVILGQDVAQNQSE---SAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISA 69
            :|.::|..:.:.:..  ||.|.|   .:....||||:|....|.|:|.::...|:.:|||.||..
Mosquito     9 LLAVVLAAISLPISS--AQQQQEERDDSATNMIVGGMKVDIEQVPYQAAILTLGQVHCGGSIIGP 71

  Fly    70 THVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEV------IMHPNYATGGHNDLAV 128
            ..|:||.|||    |.:..:.:.:..|| ....:|.||.|.|:      :..||:      |:|:
Mosquito    72 RWVLTAYHCV----DWLLPNFYEVAVGS-TNPYEGQRILVQELFVPLETLSDPNF------DIAL 125

  Fly   129 LRLQSPLTFDANIAAIQLATEDP---PNCVAVDISGWGNIAEKGPLSDSLL-FVQVTSISRGACR 189
            .:|...|.:.:.:..|.|.|.|.   |:..|. |||:|...|:.  ||::| ..|:..:....|:
Mosquito   126 AKLAHTLQYSSTVQCIPLLTSDSSLIPDTPAY-ISGFGYTKERA--SDNILKAAQIKVLPWDYCQ 187

  Fly   190 WMFYSRLPETMICLLHSKNS-GACYGDSGGPATYGGKVVGLASLLLGGGCGRA-APDGYLRISKV 252
            ..:...:.|.|:|....:.. .:|.||||||.....|:.|:  :..|.||.|. .|..|:.:...
Mosquito   188 QAYPYLMREFMLCAGFKEGKVDSCQGDSGGPLIVNAKLAGV--VFYGEGCARPHFPGVYISVPWF 250

  Fly   253 RAWIAE 258
            ..||.|
Mosquito   251 SDWIIE 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 68/231 (29%)
Tryp_SPc 37..219 CDD:238113 58/192 (30%)
AgaP_AGAP008276XP_555189.1 Tryp_SPc 39..257 CDD:238113 71/234 (30%)
Tryp_SPc 39..254 CDD:214473 68/230 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.