DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP011917

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_552323.2 Gene:AgaP_AGAP011917 / 3291454 VectorBaseID:AGAP011917 Length:246 Species:Anopheles gambiae


Alignment Length:239 Identity:69/239 - (28%)
Similarity:109/239 - (45%) Gaps:37/239 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIVGGIKAKQGQFPHQISLRLR-GEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLL 99
            ||||||.|..|..|..:|||.. .:|.|||.::|...|:::.:|:  ...:..|.:  ..|||..
Mosquito    23 RIVGGIDAVAGDAPWMVSLRNSINQHLCGGTLLSNRFVLSSANCL--SGRLATATM--AVAGSRF 83

  Fly   100 LSSDGVRIPVAEVIMHPNYATGG-HNDLAVLR--LQ-------SPLTFDANIAAIQLATEDPPNC 154
            |::..:.....::|.|||:.... .:|:|:.:  ||       .||...|::..:.         
Mosquito    84 LNTAAIPYYGIQIITHPNFNVNTLEHDVALFQTALQFILTQSVQPLPLSADVIGVG--------- 139

  Fly   155 VAVDISGWGNIAEKGPLSDSLLFVQVTSISRGACR-------WMFYSRLPETMICLLHSKNSGAC 212
            |...:.|||.....|..:::|.|:.|.::|...|.       |    |:..:.:|.|..:..|.|
Mosquito   140 VRARVFGWGASQANGGNTNALQFLNVNTLSNDDCANFLGAEGW----RIGPSSLCTLTREGQGIC 200

  Fly   213 YGDSGGPATYGGKVVGLASLLLGGGCGRAAPDGYLRISKVRAWI 256
            .||.||........:|:||  .|..|....||.::|||.||:||
Mosquito   201 GGDEGGALVLDNYAIGVAS--WGIPCATGRPDVFVRISAVRSWI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 67/237 (28%)
Tryp_SPc 37..219 CDD:238113 53/199 (27%)
AgaP_AGAP011917XP_552323.2 Tryp_SPc 23..242 CDD:214473 67/237 (28%)
Tryp_SPc 24..242 CDD:238113 66/236 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27261
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.