DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP010663

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_559166.1 Gene:AgaP_AGAP010663 / 3291136 VectorBaseID:AGAP010663 Length:161 Species:Anopheles gambiae


Alignment Length:147 Identity:42/147 - (28%)
Similarity:71/147 - (48%) Gaps:7/147 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 SIQAGSLLLSSDGVRIPVAEVIMHP--NYATGGHNDLAVLRLQSPLTFDANIAAIQLATEDPPNC 154
            ::..||..||..|:....:::::||  |..|..: |.|::::::.......||.|.|...:.|:.
Mosquito    20 TLYGGSASLSKGGIVFYASKIVIHPLFNVETADY-DAAIIQVKNSFQGYKKIARIPLQNAEVPSN 83

  Fly   155 VAVDISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMFYSRLPETMICLLHSKNSGACYGDSGGP 219
            ....::|||...:..|  |:|.:..:.:||:..|...::.......||....||...|.||||||
Mosquito    84 TLCCVAGWGYNGQTYP--DNLQYAALLAISQRQCSEAWFGLTTPENICAQRGKNGDLCTGDSGGP 146

  Fly   220 ATYGGKVVGLASLLLGG 236
            ....||:.|:.|  .||
Mosquito   147 LVCNGKLTGVTS--YGG 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 42/147 (29%)
Tryp_SPc 37..219 CDD:238113 34/128 (27%)
AgaP_AGAP010663XP_559166.1 Tryp_SPc 14..160 CDD:304450 40/144 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.