DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP004567

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_313871.5 Gene:AgaP_AGAP004567 / 3291034 VectorBaseID:AGAP004567 Length:321 Species:Anopheles gambiae


Alignment Length:271 Identity:78/271 - (28%)
Similarity:122/271 - (45%) Gaps:58/271 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVI 73
            |.|..||          :.::.|    |||||..|...::|..:.|..||..||||.:|:..:::
Mosquito    71 LYLTACG----------RGKTSS----RIVGGDAADVKEYPWIVMLLYRGAFYCGGSLINDRYIV 121

  Fly    74 TAGHCVKHGNDVVP----ADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYATGG-HNDLAVLRLQS 133
            ||.|||.   ...|    |.|:.::.|.::..:      :.::..|..::... :||:|:::||.
Mosquito   122 TAAHCVL---SFTPQQLLAKLYDVEHGEMVTRA------IVKLYGHERFSLDTFNNDIALVKLQQ 177

  Fly   134 PLTFDANIAAIQLATEDPPNCVAV----------DISGWGNIAEKGPLSDSLLFVQVTSISRGAC 188
            |:....:..         |.|:.|          .:.|||.:| .|.||..|....|..||...|
Mosquito   178 PVEAGGSFI---------PICLPVAGRSFAGQNGTVIGWGKLA-NGSLSQGLQKAIVPIISNMQC 232

  Fly   189 RWMFY--SRLPETMICLLHSKNS-GACYGDSGGPATYGG----KVVGLASLLLGGGCGRA-APDG 245
            |...|  ||:.:.|:|..:::.. .||.||||||...|.    ::||:.|  .|.||.|. .|..
Mosquito   233 RKSSYRASRITDNMLCAGYTEGGRDACQGDSGGPLNVGDSNFRELVGIVS--WGEGCARPNYPGV 295

  Fly   246 YLRISKVRAWI 256
            |.|:::...||
Mosquito   296 YTRVTRYLNWI 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 71/242 (29%)
Tryp_SPc 37..219 CDD:238113 57/199 (29%)
AgaP_AGAP004567XP_313871.5 Tryp_SPc 84..306 CDD:214473 71/242 (29%)
Tryp_SPc 85..309 CDD:238113 72/243 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.