DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP007141

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_565054.3 Gene:AgaP_AGAP007141 / 3290313 VectorBaseID:AGAP007141 Length:254 Species:Anopheles gambiae


Alignment Length:258 Identity:80/258 - (31%)
Similarity:123/258 - (47%) Gaps:32/258 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLCGVQVIL-----GQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATH 71
            :||.|..::     ..||..|.       |:|||..|..|..|:|:||:....|.|||.||....
Mosquito     8 VLCSVLCLIYAHPTPDDVEGND-------RVVGGTDAPPGAAPYQVSLQGLFGHSCGGAIIDRDW 65

  Fly    72 VITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYATG-GHNDLAVLRLQSPL 135
            ::||.|||:     .......:..|:.||::.|.|..|.:..:|..|... .|||:|:::|:|.:
Mosquito    66 ILTAAHCVQ-----TSVKFTKVLVGTNLLNAGGQRYAVEKFYVHSRYNNPVFHNDIALVKLKSMI 125

  Fly   136 TFDANIAAIQLATEDPPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMFYSRL---P 197
            .:|..:..|..:..:.|....:.::|||.::..|.:.:.|..:.:|.:....|:     ||   .
Mosquito   126 QYDDLVQPIAYSEREIPENATLTLTGWGRLSGTGAMPNKLQTIDLTYVPYEECK-----RLHGNS 185

  Fly   198 ETM----ICLLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGCGRAAPDGYLRISKVRAWI 256
            |.:    :|.|..|..|||.||||||..|.||:||:.:  .|..|....||.|.|:|....||
Mosquito   186 ENVDIGHVCTLTKKGEGACNGDSGGPLVYEGKLVGVVN--FGVPCALGYPDAYARVSYYHDWI 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 72/227 (32%)
Tryp_SPc 37..219 CDD:238113 57/189 (30%)
AgaP_AGAP007141XP_565054.3 Tryp_SPc 30..246 CDD:214473 72/227 (32%)
Tryp_SPc 31..249 CDD:238113 73/228 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.