DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Prss34

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_848459.1 Gene:Prss34 / 328780 MGIID:2681414 Length:318 Species:Mus musculus


Alignment Length:289 Identity:83/289 - (28%)
Similarity:119/289 - (41%) Gaps:54/289 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LWTVLLLLLC-GVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRL------RGEHYC 62
            ||.:.|.|.| |..:.|..|:...|....    ||||......:||.|:||||      |.||.|
Mouse     6 LWLLFLSLPCLGNTMPLTLDLGSGQGLVG----IVGGCPVSASRFPWQVSLRLYDMEHSRWEHEC 66

  Fly    63 GGVIISATHVITAGHCVKHGNDVVPADLWS----IQAGSLLLSSDGVRIPVAEVIMHPNY----- 118
            ||.:|....|:||.|||:      |.::.:    :|.|.|.|..:...:.|.::|.||.:     
Mouse    67 GGSLIHPQWVLTAAHCVR------PKEVEAYGVRVQVGQLRLYENDQLMKVVKIIRHPKFSEKLS 125

  Fly   119 ATGGHNDLAVLRLQ-----SPLTFDANIAAIQLATEDPPNCVAVDISGWGNIAEKGPLSD--SLL 176
            |.|| .|:|:|:|.     |...:..::.|..|.......|.   ::|||.|....||..  .|.
Mouse   126 ARGG-ADIALLKLDTRVVLSEHVYPVSLPAASLRISSKKTCW---VAGWGVIENYMPLPPPYHLR 186

  Fly   177 FVQVTSISRGACRWMFYSR---------LPETMICLLHSKNSGACYGDSGGPATYGGKV----VG 228
            .|.|..:....|...:.:.         :.:.|:| ...:...:|..|||||.......    ||
Mouse   187 EVAVPIVENNDCEQKYQTNSSSDSTTRIIKDDMLC-AGKEGRDSCKADSGGPLVCRWNCSWVQVG 250

  Fly   229 LASLLLGGGCGRA-APDGYLRISKVRAWI 256
            :.|  .|.|||.. .|..|.|:....:||
Mouse   251 VVS--WGIGCGLPDFPGVYTRVMSYVSWI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 72/255 (28%)
Tryp_SPc 37..219 CDD:238113 60/212 (28%)
Prss34NP_848459.1 Tryp_SPc 35..278 CDD:238113 74/256 (29%)
Tryp_SPc 35..277 CDD:214473 72/254 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.