DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG4653

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster


Alignment Length:257 Identity:91/257 - (35%)
Similarity:136/257 - (52%) Gaps:22/257 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITA 75
            |||..|.|.||  |.|:..           :.|:.|..||.||||..|.|.|||.:|....::||
  Fly    12 LLLLVVIVTLG--VVQSSR-----------LPAEVGSQPHSISLRRNGVHVCGGALIREKWILTA 63

  Fly    76 GHCVK--HGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYATG---GHNDLAVLRLQSPL 135
            .|||.  .|....||..::::.||:...:.|..:|::::|:|.||::.   |.||||:|.|::.:
  Fly    64 AHCVSLGGGQQSYPAKSYNVRVGSIQRLTGGQLVPLSKIIIHTNYSSSDAVGSNDLALLELETSV 128

  Fly   136 TFDANIAAIQLATEDPPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMFYSRLPETM 200
            ..:||...|.||||.|.....:..||||:....|.||..|......|:|...|:...|.: .|.:
  Fly   129 VLNANTNPIDLATERPAAGSQIIFSGWGSSQVDGSLSHVLQVATRQSLSASDCQTELYLQ-QEDL 192

  Fly   201 ICL--LHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGCGRAAPDGYLRISKVRAWIAEKA 260
            :||  :....:|.|.||:|.||:|..::||:|:..: .|||...||||:.:::...||.|.|
  Fly   193 LCLSPVDEDFAGLCSGDAGAPASYNNQLVGIAAFFV-SGCGSEQPDGYVDVTQHLEWINENA 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 78/226 (35%)
Tryp_SPc 37..219 CDD:238113 65/188 (35%)
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 80/223 (36%)
Tryp_SPc 30..249 CDD:214473 78/220 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473220
Domainoid 1 1.000 117 1.000 Domainoid score I5856
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 1 1.000 - - H114140
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7244
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D121264at33392
OrthoFinder 1 1.000 - - FOG0004525
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.