DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG9673

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster


Alignment Length:241 Identity:81/241 - (33%)
Similarity:117/241 - (48%) Gaps:18/241 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVKH-GNDVVPADLWS 92
            :|::.:.||:||....||::|...|:|....|.|.|.|||..|::||.|||.. |...|.|...:
  Fly    21 AEASPQGRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCVSSVGITPVDASTLA 85

  Fly    93 IQAGSLLLSSDGVRIPVAEVIMHPNYATGGHNDLAVLRLQSPLTFDANIAAIQL------ATEDP 151
            ::.|::...:.|..:.|..||:||:|....| |:|:|.|...|.|...|..|.|      .|||.
  Fly    86 VRLGTINQYAGGSIVNVKSVIIHPSYGNFLH-DIAILELDETLVFSDRIQDIALPPTTDEETEDV 149

  Fly   152 ----PNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGACRW-MFYSRLPETMICLLHSKNSGA 211
                ||...|.::|||.::: |..|.........::||..|.| ..|..  |:::||..::..|.
  Fly   150 DAELPNGTPVYVAGWGELSD-GTASYKQQKANYNTLSRSLCEWEAGYGY--ESVVCLSRAEGEGI 211

  Fly   212 CYGDSGGPATYGGKVV-GLASLLLGGGCGRAAPDGYLRISKVRAWI 256
            |.||:|.......||: ||.|... |.||...||...|:|....||
  Fly   212 CRGDAGAAVIDDDKVLRGLTSFNF-GPCGSKYPDVATRVSYYLTWI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 78/232 (34%)
Tryp_SPc 37..219 CDD:238113 65/193 (34%)
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 78/232 (34%)
Tryp_SPc 29..259 CDD:238113 79/233 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7244
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0004525
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.