DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and prss59.1

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_955899.2 Gene:prss59.1 / 322453 ZFINID:ZDB-GENE-030131-1173 Length:242 Species:Danio rerio


Alignment Length:265 Identity:75/265 - (28%)
Similarity:121/265 - (45%) Gaps:43/265 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TVLLLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATH 71
            :::.|:|.|....|..|            :||||.:.:....|.|.||. .|.|:|||.::|...
Zfish     3 SLVFLVLLGAAFALDDD------------KIVGGYECQPNSQPWQASLN-SGYHFCGGSLVSEYW 54

  Fly    72 VITAGHCVKHGNDVVPADLWSIQAGS-LLLSSDGVR--IPVAEVIMHPNYATGG-HNDLAVLRLQ 132
            |::|.||.|...:|        :.|. .::.::|..  |...:||.:|||.:.. .:|:.:::|.
Zfish    55 VVSAAHCYKSRVEV--------RLGEHNIVINEGTEQFITSEKVIRNPNYDSWDLDSDIMLIKLS 111

  Fly   133 SPLTFDANIAAIQLATEDPPNCVAVD-----ISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMF 192
            .|.|.:..:..:.|     ||..|.|     :|||||.......|:.|..:::..:|...|...:
Zfish   112 KPATLNKYVQPVAL-----PNGCAADGTMCRVSGWGNTMSSTADSNKLQCLEIPILSDRDCNNSY 171

  Fly   193 YSRLPETMIC---LLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGCG-RAAPDGYLRISKVR 253
            ...:.:||.|   |...|:|  |.||||||....|::.|:.|  .|.||. :..|..|.::....
Zfish   172 PGMITDTMFCAGYLEGGKDS--CQGDSGGPVVCNGELHGIVS--WGYGCAEKNHPGVYGKVCMFS 232

  Fly   254 AWIAE 258
            .|||:
Zfish   233 QWIAD 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 67/232 (29%)
Tryp_SPc 37..219 CDD:238113 57/193 (30%)
prss59.1NP_955899.2 Tryp_SPc 20..235 CDD:214473 67/232 (29%)
Tryp_SPc 21..238 CDD:238113 70/235 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.