DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG31681

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster


Alignment Length:236 Identity:82/236 - (34%)
Similarity:113/236 - (47%) Gaps:25/236 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSL 98
            |.|||||........|.|:|::....|.|||||.|...::||.||:   ::|...|| |::|||.
  Fly    26 EERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAILTAAHCL---SNVTVTDL-SVRAGSS 86

  Fly    99 LLSSDGVRIPVAEVIMHPNYATGGHN--DLAVLRLQSPLTFDANIAAIQLATEDPPNCVAVDISG 161
            ..|..|..:.|.:.|.||.|....:|  |:|||.|::||.....:..|.||.:.|.....|..||
  Fly    87 YWSKGGQVLKVLKTIAHPKYVPKLYNPYDIAVLILEAPLRLGGTVKKIPLAEQTPVAGTIVLTSG 151

  Fly   162 WGNIAEKGPLSDSLLF-----VQVTSISRGACRWMF-YSRLPETMICLLHSKNSGACYGDSGGP- 219
            ||...|    :.|.|:     |.|..::|..|...: :..:...||| ...:....|.|||||| 
  Fly   152 WGYTRE----NSSFLWPILQGVHVAILNRTDCLKAYKHVNITIDMIC-ADGQRWDTCQGDSGGPL 211

  Fly   220 --ATYGG--KVVGLASLLLGGGCGRAAPDGYLRISKVRAWI 256
              .|.||  :::|:.|  .|.||| ..|..|..|:....||
  Fly   212 IETTKGGHRQLIGMVS--WGDGCG-TNPGVYEDIAFFHNWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 79/232 (34%)
Tryp_SPc 37..219 CDD:238113 64/189 (34%)
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 79/232 (34%)
Tryp_SPc 29..250 CDD:238113 80/233 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.