DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG31269

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:271 Identity:85/271 - (31%)
Similarity:126/271 - (46%) Gaps:42/271 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLLLL--LCGVQVILGQDVAQNQSESAI--EPRIVGGIKAKQGQFPHQISLR-LRGEHYCGGVII 67
            |||:|  |.|:..|....:..|.::...  :.||:||..|:.|..|:||||: :.|.|.|||.||
  Fly     5 VLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAII 69

  Fly    68 SATHVITAGHCVKHGNDVVPADLW-SIQAGSLLLSSDGVRIPVAEVIMHPNYATGG-HNDLAVLR 130
            :.|.|:||.|||:  |..:|   | .:..|:...:..|.|..:..:.:|.||.... |||:|:|.
  Fly    70 NETFVLTAAHCVE--NAFIP---WLVVVTGTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLE 129

  Fly   131 LQSPLTFDANIAAIQLATEDPPNCVAVDISGWGNIAEKG--PLSDSLLFVQVTSISRGACRWMF- 192
            |..|:.:|.....|.|..........|.::|||:....|  |:...:|::|.  :....|:.:. 
  Fly   130 LVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQY--VPHRECKALLS 192

  Fly   193 ------------YSRLPETMICLLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGCGRAAPDG 245
                        :|||.|           |||:||||||....|.:|||.:  .|..|....||.
  Fly   193 NDEDCDVGHICTFSRLGE-----------GACHGDSGGPLVSNGYLVGLVN--WGWPCATGVPDV 244

  Fly   246 YLRISKVRAWI 256
            :..:...|.||
  Fly   245 HASVYFYRDWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 75/237 (32%)
Tryp_SPc 37..219 CDD:238113 63/199 (32%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 75/237 (32%)
Tryp_SPc 38..258 CDD:238113 76/238 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.