DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG31267

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster


Alignment Length:269 Identity:79/269 - (29%)
Similarity:126/269 - (46%) Gaps:27/269 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TTLWTVLLLLLCGVQVILGQDVAQNQSESA--IEPRIVGGIKAKQGQFPHQISLR-LRGEHYCGG 64
            :||..|||.|......:..:.....:||:|  ...|||||.::.....|:.:||: ..|.|:|.|
  Fly     9 STLVLVLLALSFSEASLRRRAFTSEKSETANKFSSRIVGGEESDVLAAPYLVSLQNAYGNHFCAG 73

  Fly    65 VIISATHVITAGHCV----KHGNDVVPA--DLWSIQAGSLLLSSDGVRIPVAEVIMHPNY-ATGG 122
            .||....||||..|:    |:...||..  :.|         .|:|....|.:::||.|: :...
  Fly    74 SIIHDQWVITAASCLAGLRKNNVQVVTTTYNHW---------GSEGWIYSVEDIVMHCNFDSPMY 129

  Fly   123 HNDLAVLRLQSPLTFDANIAAIQLA-TEDPPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRG 186
            |||:|:::..:...:|.....|.:| .||..:...:.:.|:|:....|..|..|..:.||.::..
  Fly   130 HNDIALIKTHALFDYDDVTQNITIAPLEDLTDGETLTMYGYGSTEIGGDFSWQLQQLDVTYVAPE 194

  Fly   187 ACRWMFYSRLPET---MICLLHSKNSGACYGDSGGPATYG-GKVVGLASLLLGGGCGRAAPDGYL 247
            .|. ..|...|:.   .:|.:....:|||:||:|||.... |::||:.:  .|..||...||.:.
  Fly   195 KCN-ATYGGTPDLDVGHLCAVGKVGAGACHGDTGGPIVDSRGRLVGVGN--WGVPCGYGFPDVFA 256

  Fly   248 RISKVRAWI 256
            |||...:||
  Fly   257 RISFYYSWI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 68/232 (29%)
Tryp_SPc 37..219 CDD:238113 54/193 (28%)
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 68/232 (29%)
Tryp_SPc 45..268 CDD:238113 69/233 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27261
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.