DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG32834

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001188996.1 Gene:CG32834 / 318238 FlyBaseID:FBgn0052834 Length:556 Species:Drosophila melanogaster


Alignment Length:271 Identity:76/271 - (28%)
Similarity:121/271 - (44%) Gaps:35/271 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LWTVLLLLLCG-VQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIIS 68
            :|:|.|.||.. ::.:.|...||:        ||:||........|:|..:.:.|...|.|.||:
  Fly     2 IWSVFLFLLAALLRPVRGDLDAQS--------RIIGGYDVDIEDAPYQAEVIIDGTAICSGAIIT 58

  Fly    69 ATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGV--RIPVAEVIMHPNY-ATGGHNDLAVLR 130
            :..:|||..||:....:      .::.|:.....||.  .:.|.|:|.||.| .....|:||:|:
  Fly    59 SDTIITAASCVQSYGSI------EVRVGTSSRDYDGTGFLLEVCEIINHPQYNCWRFDNNLALLK 117

  Fly   131 LQSPLTFDANIAAIQLATEDPPNCVAVDISGWGNIA------EK--GPLSDSLLFVQVTSISRGA 187
            |..||.....|..|.:|.::|.:.....:||||:.:      ::  |.|.|.|....|:..:|..
  Fly   118 LCDPLKTSEAIQPISIAEDEPDDGSWCTVSGWGSTSWWGSWWDRCFGSLPDYLQMAWVSVYNREQ 182

  Fly   188 C---RWMFYSRLPE--TMICLLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGCGRAAPDGYL 247
            |   |.:::.....  :.:.|.....:|.|..|:|.|....|::||:.|   .||| ...||.|.
  Fly   183 CAADRGVWFGLWDNGISYLTLCTHNGAGGCSYDTGAPLVIDGQLVGILS---EGGC-TTKPDVYA 243

  Fly   248 RISKVRAWIAE 258
            .:.....||||
  Fly   244 NVPWFTGWIAE 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 64/235 (27%)
Tryp_SPc 37..219 CDD:238113 52/197 (26%)
CG32834NP_001188996.1 Tryp_SPc 26..252 CDD:214473 64/235 (27%)
Tryp_SPc 27..255 CDD:238113 67/238 (28%)
BES1_N <293..343 CDD:283367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.