DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG6041

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster


Alignment Length:278 Identity:84/278 - (30%)
Similarity:133/278 - (47%) Gaps:32/278 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LWTVLLLLLCGVQVILGQDVAQNQSESA--IEPRIVGGIKAKQGQFPHQISLRLRGE-------- 59
            :|.:|.:.|....:..|:.::   ||:|  |||:||||..|...|..:|:|:||...        
  Fly     4 VWAILAIALFLGALASGESLS---SETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSG 65

  Fly    60 HYCGGVIISATHVITAGHC--VKHGNDVVPADLWSIQAGSLLLSSDGVR---IPVAEVIMHPNYA 119
            |.||||:||...|.||.||  :........|..:.:..||..|:|...|   ..:.::|.|.||.
  Fly    66 HLCGGVVISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENYN 130

  Fly   120 TGG-HNDLAVLRLQSPLTFD-ANIAAIQLATE---DPPNCVAVDISGWGNIAEKGPL-SDSLLFV 178
            ... .||:|::.:...:.:: ..:.|:.|.::   ...:|:   |||||.:.:.|.. |::|...
  Fly   131 PDALTNDIALMFINGYIPWNWPTVTALALNSQLVATNTDCL---ISGWGLLQQNGTFSSNTLQAA 192

  Fly   179 QVTSISRGACRWMFYSRLPETMICLLH-SKNSGACYGDSGGPATYGGKVVGLASLLLGGGCGRAA 242
            .|..:|...|| :.|:.:|.:.:|..: |....||.||||||.:..|.:.|:.|  .|.||....
  Fly   193 TVPIVSYTTCR-ISYNSIPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVS--YGAGCAAPG 254

  Fly   243 -PDGYLRISKVRAWIAEK 259
             |..|..:|....||.:|
  Fly   255 YPGVYTNVSYYYDWIVQK 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 71/240 (30%)
Tryp_SPc 37..219 CDD:238113 60/201 (30%)
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 71/240 (30%)
Tryp_SPc 35..272 CDD:238113 73/242 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.