DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Klk12

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_008757573.1 Gene:Klk12 / 308564 RGDID:1308975 Length:247 Species:Rattus norvegicus


Alignment Length:258 Identity:77/258 - (29%)
Similarity:119/258 - (46%) Gaps:32/258 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHY-CGGVIISATHV 72
            :|||||    ::|...|..:       :|..|::..:...|.|:.| ..|::. ||||::....|
  Rat     5 ILLLLC----VVGLSQADRE-------KIYNGVECVKNSQPWQVGL-FHGKYLRCGGVLVDRKWV 57

  Fly    73 ITAGHCVKHGNDVVPADLWSIQAGSLLLS----SDGVRIPVAEVIMHPNY--ATGGH-NDLAVLR 130
            :||.||         :..:.::.|...||    ::.:|:.... |.||:|  |...| :||.:||
  Rat    58 LTAAHC---------SGKYMVRLGEHSLSKLDLTEQLRLTTFS-ITHPSYHGAYQNHEHDLRLLR 112

  Fly   131 LQSPLTFDANIAAIQLATEDPPNCVAVDISGWGNIAEK-GPLSDSLLFVQVTSISRGACRWMFYS 194
            |..|::....:..:.|.:...|......|||||...:. .|..|.|..:.::.:|...||.:|..
  Rat   113 LNRPISLTYAVRPVALPSSCAPTGAKCHISGWGTTNKPWDPFPDRLQCLDLSIVSNETCRAVFPG 177

  Fly   195 RLPETMICLLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGCG-RAAPDGYLRISKVRAWI 256
            |:.|.|:|........||.||||||...||.:.||.|....|.|| :..|..|.::.|...||
  Rat   178 RVTENMLCAGGEAGKDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQKGIPGVYTKVCKYTDWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 68/229 (30%)
Tryp_SPc 37..219 CDD:238113 55/190 (29%)
Klk12XP_008757573.1 Tryp_SPc 21..240 CDD:214473 68/229 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.