DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Tpsg1

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_783183.1 Gene:Tpsg1 / 302990 RGDID:631355 Length:311 Species:Rattus norvegicus


Alignment Length:258 Identity:73/258 - (28%)
Similarity:115/258 - (44%) Gaps:22/258 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 CGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHC 78
            ||..::|..........|....|||||..|:.|.:|.|.||||:..|.|||.::|...|:||.||
  Rat     7 CGFLLLLAVPGCGQPQVSHAGSRIVGGHAAQAGAWPWQASLRLQKVHVCGGSLLSPEWVLTAAHC 71

  Fly    79 VKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNY--ATGGHNDLAVLRLQSPLTFDANI 141
              ....|..:| :.:..|.|.::.......|.::||:.:.  ..|...|:|:::|.:|:...:.:
  Rat    72 --FSGSVNSSD-YEVHLGELTITLSPHFSTVKQIIMYSSAPGPPGSSGDIALVQLATPVALSSQV 133

  Fly   142 AAIQL--ATEDPPNCVAVDISGWGNIAEKGPLSD--SLLFVQVTSISRGACRWMFYSR----LPE 198
            ..:.|  |:.|....:...::|||...|..||..  :|...:|:.:....|...:.|.    :..
  Rat   134 QPVCLPEASADFHPGMQCWVTGWGYTQEGEPLKPPYNLQEAKVSVVDVETCSQAYSSSNGSLIQS 198

  Fly   199 TMICLLHSKNSGACYGDSGGPATYGGKVVGL----ASLLLGGGCGRA-APDGYLRISKVRAWI 256
            .|:|....  ..||..|||||...  :|.|:    ..:..|.||||. .|..|.|::....||
  Rat   199 DMLCAWGP--GDACQDDSGGPLVC--RVAGIWQQAGVVSWGEGCGRPDRPGVYARVTAYVNWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 67/234 (29%)
Tryp_SPc 37..219 CDD:238113 54/191 (28%)
Tpsg1NP_783183.1 Tryp_SPc 29..257 CDD:214473 67/234 (29%)
Tryp_SPc 30..260 CDD:238113 68/235 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346428
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.