DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Prss32

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001100453.1 Gene:Prss32 / 302970 RGDID:1311905 Length:334 Species:Rattus norvegicus


Alignment Length:308 Identity:90/308 - (29%)
Similarity:137/308 - (44%) Gaps:68/308 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWTTLWTVLLLLLCGVQVILGQDVAQNQS--------ESAIE-----------PRIVGGIKAKQG 46
            |...|..:|..||.|  |:||.:|....|        .|:|:           .|||.|..|:.|
  Rat     1 MELALAVILYTLLPG--VLLGSEVLTTDSYSLSTQTGRSSIDLDSVCGRPRASGRIVSGQNAQLG 63

  Fly    47 QFPHQISLRLRGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIP--- 108
            |:|.|:|:|..|.|.|||.:||...|:||.||......:   ..:::..|:  :||    .|   
  Rat    64 QWPWQVSVREDGVHVCGGSLISEDWVLTAAHCFNQDQHL---SAYTVLLGT--ISS----YPEDN 119

  Fly   109 -------VAEVIMHPNYATGGHN--DLAVLRLQSPLTFDANIAAIQLATEDPPNCVAVD------ 158
                   ||:.|.:|:|:...|:  |:|:|:|.||::|:..:..:.|.....|    :|      
  Rat   120 EPRELRAVAQYIKYPSYSAEEHSSGDIALLQLASPISFNDYMLPVCLPKPGDP----LDPGTMCW 180

  Fly   159 ISGWGNIAEKGPLSD--SLLFVQVTSISRGACRWMFY-SRLPET-------MIC--LLHSKNSGA 211
            ::||||||...||..  :|..:||..|....|...:. :.:|.|       |:|  .:..|.. |
  Rat   181 VTGWGNIATNQPLPPPFTLQELQVPLIDAKTCNTYYQENSVPSTEQVILEDMLCAGFVEGKKD-A 244

  Fly   212 CYGDSGGPATYGGKVVGLASLLL--GGGCGRA-APDGYLRISKVRAWI 256
            |.||||||.......|.:.:.::  |..|..: .|..|..:|...:||
  Rat   245 CNGDSGGPLVCDVNDVWIQAGVVSWGSDCALSNRPGVYTNVSVYISWI 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 75/252 (30%)
Tryp_SPc 37..219 CDD:238113 66/211 (31%)
Prss32NP_001100453.1 Tryp_SPc 53..292 CDD:214473 75/252 (30%)
Tryp_SPc 54..295 CDD:238113 76/253 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.