DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Elane

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001100237.1 Gene:Elane / 299606 RGDID:1307968 Length:271 Species:Rattus norvegicus


Alignment Length:270 Identity:74/270 - (27%)
Similarity:119/270 - (44%) Gaps:54/270 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TLWTVL--LLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVI 66
            ||.::|  |||:|                .|:...||||..|:...:|..:||:.||.|:||..:
  Rat    14 TLASMLLALLLVC----------------PALASEIVGGRPAQPHAWPFMVSLQRRGGHFCGATL 62

  Fly    67 ISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGV--RIPVAEVIMHPNYATGGH------ 123
            |:...|::|.|||...|         .|:..::|.:..:  |.|..::.........|.      
  Rat    63 IARNFVMSAAHCVNGRN---------FQSVQVVLGAHDLRRREPTRQIFSVQRIFENGFDPSRLL 118

  Fly   124 NDLAVLRLQSPLTFDANIAAIQLATE-----DPPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSI 183
            ||:.:::|....|.:||:...:|..:     :...|||:   |||.:....||...|..:.||.:
  Rat   119 NDIVIIQLNGSATINANVQVAELPAQGQGVGNRTPCVAM---GWGRLGTNRPLPSVLQELNVTVV 180

  Fly   184 SRGACRWMFYSRLPETMIC-LLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGCGRA-APDGY 246
            : ..||       ....:| |:..:.:|.|:||||||......|.|:.| .:.||||.. .||.:
  Rat   181 T-NLCR-------RRVNVCTLVPRRQAGICFGDSGGPLVCNNLVQGIDS-FIRGGCGSGFYPDAF 236

  Fly   247 LRISKVRAWI 256
            ..:::...||
  Rat   237 APVAEFADWI 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 64/234 (27%)
Tryp_SPc 37..219 CDD:238113 53/195 (27%)
ElaneNP_001100237.1 Tryp_SPc 32..246 CDD:214473 64/234 (27%)
Tryp_SPc 33..249 CDD:238113 66/235 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.