DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Klk1c3

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001258244.1 Gene:Klk1c3 / 292872 RGDID:735032 Length:255 Species:Rattus norvegicus


Alignment Length:275 Identity:80/275 - (29%)
Similarity:121/275 - (44%) Gaps:47/275 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LWTVLLLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISA 69
            :|.::|.|    .:.|||..|....:|    |:|||.|.::...|.|::  :..|..||||:|..
  Rat     1 MWFLILFL----ALSLGQIDAAPPGQS----RVVGGFKCEKNSQPWQVA--VINEDLCGGVLIDP 55

  Fly    70 THVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNY---ATGGH-------- 123
            :.||||.||.        :|.:.:..|...||.|.....|::...||:|   ....|        
  Rat    56 SWVITAAHCY--------SDNYHVLLGQNNLSEDVQHRLVSQSFRHPDYKPFLMRNHTRKPKDYS 112

  Fly   124 NDLAVLRLQSPLTFDANIAAIQLATEDP---PNCVAVDISGWGNI-AEKGPLSDSLLFVQVTSIS 184
            |||.:|.|..|......:..|.|.|::|   ..|:   :||||:. ..:....|.|..|.:..:|
  Rat   113 NDLMLLHLSEPADITDGVKVIDLPTKEPKVGSTCL---VSGWGSTNPSEWEFPDDLQCVNIHLLS 174

  Fly   185 RGACRWMFYSRLPETMIC---LLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGG--CGRAAPD 244
            ...|...:..::.:.|:|   |...|::  |.||||||....|.:.|:.|   .|.  ||.....
  Rat   175 NEKCIKAYKEKVTDLMLCAGELEGGKDT--CRGDSGGPLICDGVLQGITS---WGSVPCGEPNKP 234

  Fly   245 G-YLRISKVRAWIAE 258
            | |.::.|..:||.|
  Rat   235 GIYTKLIKFTSWIKE 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 69/240 (29%)
Tryp_SPc 37..219 CDD:238113 57/199 (29%)
Klk1c3NP_001258244.1 Tryp_SPc 24..247 CDD:214473 69/240 (29%)
Tryp_SPc 25..250 CDD:238113 71/243 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.