DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Klk9

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001099723.1 Gene:Klk9 / 292851 RGDID:1308280 Length:258 Species:Rattus norvegicus


Alignment Length:268 Identity:68/268 - (25%)
Similarity:102/268 - (38%) Gaps:44/268 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LWTVLLLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISA 69
            |..||..||.|              ....:.|.||..:.::...|.|..|.......||..:|:.
  Rat     5 LTLVLFSLLAG--------------HCGADTRAVGARECQRNSQPWQAGLFYLTRQLCGATLIND 55

  Fly    70 THVITAGHC------VKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNY----ATGGHN 124
            ..::||.||      |:.|..    .||..:....||.       |.:...||.:    :...||
  Rat    56 QWLLTAAHCRKPYLWVRLGEH----HLWQWEGPEKLLL-------VTDFFPHPGFNPDLSANDHN 109

  Fly   125 -DLAVLRLQSPLTFDANIAAIQLATEDPPNCVAVDISGWGNI-AEKGPLSDSLLFVQVTSISRGA 187
             |:.::||...:.....:..:.|:...|.......|||||:: :.|.....:|....::.:....
  Rat   110 DDIMLIRLPRKVRLSPAVQPLNLSQSLPSVGTQCLISGWGSVSSSKIQFPMTLQCANISILDNKL 174

  Fly   188 CRWMFYSRLPETMICL-LHSKNSGACYGDSGGPATYGGKVVGLASLLLGGG--CGR-AAPDGYLR 248
            |||.:...:.|.|:|. |.....|:|.||||||....|.:.|:.|   ||.  |.| ..|..|..
  Rat   175 CRWAYPGHISEKMLCAGLWEGGRGSCQGDSGGPLVCKGTLAGIVS---GGSEPCSRPQRPAVYTS 236

  Fly   249 ISKVRAWI 256
            :.....||
  Rat   237 VFHYLDWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 60/235 (26%)
Tryp_SPc 37..219 CDD:238113 48/194 (25%)
Klk9NP_001099723.1 Tryp_SPc 24..247 CDD:238113 61/235 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.