DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Klk10

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001004100.1 Gene:Klk10 / 292850 RGDID:1303242 Length:279 Species:Rattus norvegicus


Alignment Length:275 Identity:71/275 - (25%)
Similarity:108/275 - (39%) Gaps:54/275 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LWTVLLLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISA 69
            ||....|||.|           |.:...:|  ..|.:.....| |.|:||....:..|.||::..
  Rat    29 LWAAQALLLPG-----------NTTREDLE--AFGTLCPSVSQ-PWQVSLFHNLQFQCAGVLVDQ 79

  Fly    70 THVITAGHCVKH-------GNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNY--------- 118
            ..|:||.||.::       |:|.:           ||..|:.:| .....:.||.|         
  Rat    80 NWVLTAAHCWRNKPLRARVGDDHL-----------LLFQSEQLR-STNSPVFHPKYQPCSGPVLP 132

  Fly   119 ATGGHNDLAVLRLQSPLTFDANIAAIQLATEDPPNCV----AVDISGWGNIAEKG-PLSDSLLFV 178
            .....:||.:|:|.||:...:.:..:||    |..|.    ...:||||..|.:. ..:.||...
  Rat   133 LRSDEHDLMMLKLSSPVVLTSKVHPVQL----PFQCAQPRQECQVSGWGTTANRRVKYNRSLSCS 193

  Fly   179 QVTSISRGACRWMFYSRLPETMICLLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGCGRAA- 242
            :||.:|:..|...:...:...|||....::..:|..|||||......:.|:.|..: ..||.|. 
  Rat   194 RVTLLSQKQCETFYPGVITNNMICAGMDRDQDSCQSDSGGPLVCDNTLHGILSWSI-YPCGAATQ 257

  Fly   243 -PDGYLRISKVRAWI 256
             |..|.:|.....||
  Rat   258 YPAVYAKICNYTNWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 61/242 (25%)
Tryp_SPc 37..219 CDD:238113 51/202 (25%)
Klk10NP_001004100.1 Tryp_SPc 50..272 CDD:214473 61/239 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.