DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Klk11

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001099722.1 Gene:Klk11 / 292849 RGDID:1308690 Length:279 Species:Rattus norvegicus


Alignment Length:242 Identity:63/242 - (26%)
Similarity:98/242 - (40%) Gaps:32/242 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVK-HGNDVVPADLWSIQAGS 97
            |.||:.|.:.:....|.|::|..:....||..:|:...::||.||.| |         :.|..|.
  Rat    48 ETRIIKGYECRPHSQPWQVALFQKTRLLCGATLIAPKWLLTAAHCRKPH---------YVILLGE 103

  Fly    98 -LLLSSDGV--RIPVAEVIMHPNYATG-----GHNDLAVLRLQSPLTFDANIAAIQLATEDPPNC 154
             .|..:||.  |....|...||.:...     ..||:.::::.||......:..:.|::    .|
  Rat   104 HNLEKTDGCEQRRMATESFPHPGFNNSLPNKDHRNDIMLVKMSSPAFITRAVRPLTLSS----LC 164

  Fly   155 VAVD----ISGWGNIAEKGP---LSDSLLFVQVTSISRGACRWMFYSRLPETMICL-LHSKNSGA 211
            |...    |||||..:  .|   |..||....|:.|....|...:...:.:||:|. :..:...:
  Rat   165 VTAGTSCLISGWGTTS--SPQLRLPHSLRCANVSIIGHKECERAYPGNITDTMLCASVRKEGKDS 227

  Fly   212 CYGDSGGPATYGGKVVGLASLLLGGGCGRAAPDGYLRISKVRAWIAE 258
            |.||||||....|.:.|:.|...........|..|.::.|...||.|
  Rat   228 CQGDSGGPLVCNGSLQGIISWGQDPCAVTRKPGVYTKVCKYFDWIHE 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 59/236 (25%)
Tryp_SPc 37..219 CDD:238113 50/198 (25%)
Klk11NP_001099722.1 Tryp_SPc 50..272 CDD:214473 59/236 (25%)
Tryp_SPc 51..275 CDD:238113 61/239 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.