DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Klk13

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001163876.1 Gene:Klk13 / 292848 RGDID:1309337 Length:276 Species:Rattus norvegicus


Alignment Length:284 Identity:80/284 - (28%)
Similarity:124/284 - (43%) Gaps:53/284 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWTTLWTVLLLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQG-------QFPH----QISL 54
            ||..:.|:..|.|.     |...::::.      |:|:.|.....|       ..||    |.:|
  Rat     1 MWPLVATIACLTLA-----LSGGISRDY------PKILNGTNGTSGFLPGGYTCLPHSQPWQAAL 54

  Fly    55 RLRGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLS--SDGVR-IPVAEVIMHP 116
            .:||...||||::....|:||.||.|.|        :::..|...|.  .:|.: :.|...|.||
  Rat    55 LVRGRLLCGGVLVHPKWVLTAAHCRKDG--------YTVHLGKHALGRVENGEQAMEVVRSIPHP 111

  Fly   117 NYATG----GH-NDLAVLRLQSPLTFDANIAAIQLATED-PPNCVAVDISGWGNIAEKGPLSDSL 175
            .|...    .| :|:.:|.|:||:....::..:||:.:| .|......:||||...  .|..:..
  Rat   112 EYQVSPTHLNHDHDIMLLELKSPVQLSNHVRTLQLSADDCLPTGTCCRVSGWGTTT--SPQVNYP 174

  Fly   176 LFVQVTSI---SRGACRWMFYSRLPETMICLLHSKNSG--ACYGDSGGPATYGGKVVGLASLLLG 235
            ..:|..:|   |...||.::..::...|:| ..:|..|  :|.||||||....||:.|:.|   .
  Rat   175 KTLQCANIELRSDEECRQVYPGKITANMLC-AGTKEGGKDSCEGDSGGPLICNGKLYGIIS---W 235

  Fly   236 GG--CGRA-APDGYLRISKVRAWI 256
            |.  ||:. .|..|.|:||...||
  Rat   236 GDFPCGQPNRPGVYTRVSKYLRWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 71/247 (29%)
Tryp_SPc 37..219 CDD:238113 57/206 (28%)
Klk13NP_001163876.1 Tryp_SPc 39..262 CDD:238113 70/235 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.