DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Tpsb2

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_062053.2 Gene:Tpsb2 / 29268 RGDID:3065 Length:274 Species:Rattus norvegicus


Alignment Length:283 Identity:81/283 - (28%)
Similarity:128/283 - (45%) Gaps:55/283 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLLL-------------CGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGE- 59
            |||||             |.|:..:|               ||||.:|.:.::|.|:|||.:.. 
  Rat     4 LLLLLALSPLASLVHAAPCPVKQRVG---------------IVGGREASESKWPWQVSLRFKFSF 53

  Fly    60 --HYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYAT-- 120
              |:|||.:|....|:||.|||  |..:...:|:.:|.....|......:.|...::||:|.|  
  Rat    54 WMHFCGGSLIHPQWVLTAAHCV--GLHIKSPELFRVQLREQYLYYADQLLTVNRTVVHPHYYTVE 116

  Fly   121 -GGHNDLAVLRLQSPLTFDANIAAIQL--ATEDPPNCVAVDISGWGNIAEKGPLSD--SLLFVQV 180
             |.  |:|:|.|::|:....:|....|  |:|..|:..:..::|||:|....||..  .|..|:|
  Rat   117 DGA--DIALLELENPVNVSTHIHPTSLPPASETFPSGTSCWVTGWGDIDSDEPLLPPYPLKQVKV 179

  Fly   181 TSISRGACRWMFYSRL---------PETMICLLHSKNSGACYGDSGGPATYGGKVVGLASLLL-- 234
            ..:....|...:::.|         .:.|:|..::: |.:|.||||||.....|...|.:.::  
  Rat   180 PIVENSLCDRKYHTGLYTGDDVPIVQDGMLCAGNTR-SDSCQGDSGGPLVCKVKGTWLQAGVVSW 243

  Fly   235 GGGCGRA-APDGYLRISKVRAWI 256
            |.||..| .|..|.|::....||
  Rat   244 GEGCAEANRPGIYTRVTYYLDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 71/241 (29%)
Tryp_SPc 37..219 CDD:238113 60/200 (30%)
Tpsb2NP_062053.2 Tryp_SPc 30..268 CDD:238113 73/242 (30%)
Tryp_SPc 30..266 CDD:214473 71/240 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346452
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.