DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Tmprss7

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001099352.2 Gene:Tmprss7 / 288118 RGDID:1304655 Length:829 Species:Rattus norvegicus


Alignment Length:251 Identity:74/251 - (29%)
Similarity:108/251 - (43%) Gaps:50/251 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLL 100
            |:|||..:::|.:|.|:||...|..:||..:||...:::|.||. |||.:.....|:...|..:.
  Rat   591 RVVGGSDSQEGTWPWQVSLHFVGSAHCGASVISREWLLSAAHCF-HGNRLSDPTPWTAHLGMYVQ 654

  Fly   101 SSDGVRIPVAEVIMHPNYATGGHNDLAVLRLQSPLTFDANIAAIQLATEDP--------PNCV-- 155
            .:.....||..:::|..|              :..|||.:||.:||:...|        |.|:  
  Rat   655 GNAKFVSPVRRIVVHEYY--------------NSQTFDYDIALLQLSIAWPETLRQLIQPICIPP 705

  Fly   156 ---------AVDISGWGNIAE---KGPLSDSLLFVQVTSISRGACRWMFYSRLPETMICL-LHSK 207
                     ...::|||...|   ||  |..|...:|..|.:..| ...|..:...|:|. :.|.
  Rat   706 VGQRVRSGEKCWVTGWGRRHEADSKG--SPILQQAEVELIDQTVC-VSTYGIITSRMLCAGVMSG 767

  Fly   208 NSGACYGDSGGPATYGGK------VVGLASLLLGGGCGRA-APDGYLRISKVRAWI 256
            .|.||.||||||.:...|      :.|:.|  .|.||||. .|..|.|:|....||
  Rat   768 KSDACKGDSGGPLSCRRKSDGKWILTGIVS--WGYGCGRPNFPGVYTRVSNFVPWI 821

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 72/249 (29%)
Tryp_SPc 37..219 CDD:238113 57/204 (28%)
Tmprss7NP_001099352.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..49
SEA 94..190 CDD:279699
CUB <257..345 CDD:238001
LDLa 470..504 CDD:238060
LDLa 545..580 CDD:238060
Tryp_SPc 591..821 CDD:214473 72/249 (29%)
Tryp_SPc 592..823 CDD:238113 73/250 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.