DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Prss38

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_006246600.1 Gene:Prss38 / 287358 RGDID:1565729 Length:380 Species:Rattus norvegicus


Alignment Length:267 Identity:74/267 - (27%)
Similarity:125/267 - (46%) Gaps:33/267 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITA 75
            ||.||.:..|...::....:.|:..:::||......::|.|:|:...|.|.|||.|::|..|:||
  Rat    88 LLWCGREPSLHLFLSSACGQPALHGKLLGGELTIDRKWPWQVSIHYAGFHVCGGSILNAYWVLTA 152

  Fly    76 GHCVKHGNDVVPADLWSIQAGSLLLSSDGVR-IPVAEVIMHPNY----ATGGHNDLAVLRLQSPL 135
            .||......:...|:: :...:|.:::...: ..:.:||:||.:    ..||  |:|:::.:|.:
  Rat   153 AHCFAREKRLQTFDMY-VGITNLEVANKHTQWFEINQVIIHPTFEMFHPVGG--DVALVQSKSAI 214

  Fly   136 TFDANIAAIQLATEDPPNCVAVDIS----GWGNIAEKGPLSDSLLFVQVTSISRGACRWMF---- 192
            .|...:..|.|.:.   |....|:|    |||.::.:|.....||..|:..|.:..|:.::    
  Rat   215 VFSDYVLPICLPSS---NLNLSDLSCWTTGWGMVSPQGETGKDLLEAQLPLIPKFQCQLLYGLTS 276

  Fly   193 YSRLPETMICLLHSKN-SGACYGDSGGPATYGGKV------VGLASLLLGGGCGRAA-PDGYLRI 249
            | .||| |:|....|| ...|.||||.|...  ||      :|:.|  .|.||.:.. |..:..:
  Rat   277 Y-LLPE-MLCAGDIKNMKNVCEGDSGSPLVC--KVNQTWLQIGIVS--WGRGCAQPLYPGVFANV 335

  Fly   250 SKVRAWI 256
            |....||
  Rat   336 SYFLNWI 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 66/240 (28%)
Tryp_SPc 37..219 CDD:238113 56/195 (29%)
Prss38XP_006246600.1 Tryp_SPc 116..343 CDD:238113 68/239 (28%)
Tryp_SPc 116..342 CDD:214473 66/237 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.