DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Prss34

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:282 Identity:84/282 - (29%)
Similarity:121/282 - (42%) Gaps:42/282 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LWTVLLLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRL------RGEHYCG 63
            ||.:.|.|.|     ||..:............||||......:||.|:|||.      :.||.||
  Rat     6 LWFLFLTLPC-----LGSTMPLTPDSGQELVGIVGGCPVSASRFPWQVSLRFYNMKLSKWEHICG 65

  Fly    64 GVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNY-----ATGGH 123
            |.:|....|:||.|||:...  :.|..:.:|.|.|.|..:...:.||::|.||.:     |.|| 
  Rat    66 GSLIHPQWVLTAAHCVELKE--MEASCFRVQVGQLRLYENDQLMKVAKIIRHPKFSEKLSAPGG- 127

  Fly   124 NDLAVLRLQSPLTFDANIAAIQL--ATEDPPNCVAVDISGWGNIAEKGPLSD--SLLFVQVTSIS 184
            .|:|:|:|.|.:.....:..:.|  |::...:.....::|||.|....||..  .|..|.|..:.
  Rat   128 ADIALLKLDSTVVLSERVHPVSLPAASQRISSKKTWWVAGWGVIEGHRPLPPPCHLREVAVPIVG 192

  Fly   185 RGAC--RWMFYSRLPET-------MICL-LHSKNSGACYGDSGGPATYGGKV----VGLASLLLG 235
            ...|  ::..||.|..|       |:|. :..::|  |..|||||.......    ||:.|  .|
  Rat   193 NSDCEQKYRTYSSLDRTTKIIKDDMLCAGMEGRDS--CQADSGGPLVCRWNCSWVQVGVVS--WG 253

  Fly   236 GGCGRA-APDGYLRISKVRAWI 256
            .|||.. .|..|.|:....:||
  Rat   254 IGCGLPDFPGVYTRVMSYLSWI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 75/249 (30%)
Tryp_SPc 37..219 CDD:238113 63/206 (31%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 77/250 (31%)
Tryp_SPc 33..275 CDD:214473 75/248 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.