DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Prss29

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_017453326.1 Gene:Prss29 / 287136 RGDID:1305856 Length:279 Species:Rattus norvegicus


Alignment Length:290 Identity:86/290 - (29%)
Similarity:134/290 - (46%) Gaps:53/290 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWTTLWTVLLLL---LCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRL------ 56
            |.:.|...|:.|   :.|:...:.:||...         ||||..|.||::|.|:|||:      
  Rat     1 MLSQLGLTLIFLGSSIAGIPASVPEDVLVG---------IVGGNSAPQGKWPWQVSLRVYRYNWA 56

  Fly    57 RGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYATG 121
            ...|.|||.||....|:||.||: |.:|..|: .:.|..|.:.|......:.|:.||:||::...
  Rat    57 SWVHICGGSIIHPQWVLTAAHCI-HESDADPS-AFRIYLGQVYLYGGEKLLKVSRVIIHPDFVRS 119

  Fly   122 G-HNDLAVLRLQSPLTFDANIAAIQLATEDPPNCVAVD------ISGWGNIA--EKGPLSDSLLF 177
            | .:|:|:|:|...:....|:..::|:    |..:.|.      ::|||:::  |..|....|..
  Rat   120 GLGSDVALLQLAQSVRSFPNVKPVKLS----PASLEVTKKDVCWVTGWGSVSMHESLPPPYRLQQ 180

  Fly   178 VQVTSISRGACRWMF--YSRLP--------ETMICL-LHSKNSGACYGDSGGP----ATYGGKVV 227
            |||..:....|..::  .:||.        :.|:|. .|.::|  ||||||||    .|....:|
  Rat   181 VQVKIVDNTLCEKLYRNATRLSNHGQRLILQDMLCAGSHGRDS--CYGDSGGPLVCNVTGSWTLV 243

  Fly   228 GLASLLLGGGCG-RAAPDGYLRISKVRAWI 256
            |:.|  .|.||. :..|..|.|:.....||
  Rat   244 GVVS--WGYGCALKDIPGVYARVQFFLPWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 77/250 (31%)
Tryp_SPc 37..219 CDD:238113 65/207 (31%)
Prss29XP_017453326.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346482
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.