DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and LOC286960

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_775423.1 Gene:LOC286960 / 286960 RGDID:708585 Length:247 Species:Rattus norvegicus


Alignment Length:249 Identity:69/249 - (27%)
Similarity:117/249 - (46%) Gaps:26/249 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVKHGND 84
            ||..||...::   :.:||||....:...|:|:||.....|.|||.:||...|::|.||.|....
  Rat    10 LGAAVALPVND---DDKIVGGYTCPKHLVPYQVSLHDGISHQCGGSLISDQWVLSAAHCYKRKLQ 71

  Fly    85 VVPAD--LWSIQAGSLLLSSDGVRIPVAEVIMHPNYATGG-HNDLAVLRLQSPLTFDANIAAIQL 146
            |...:  :..::.|...:.::       ::|.||.|.... .||:.:::|:||...::.::.:.|
  Rat    72 VRLGEHNIHVLEGGEQFIDAE-------KIIRHPEYNKDTLDNDIMLIKLKSPAVLNSQVSTVSL 129

  Fly   147 ATEDPPNCVAVD----ISGWGNIAEKGPLSDSLL-FVQVTSISRGACRWMFYSRLPETMICL-LH 205
                |.:|.:.|    :|||||....|....:|| .::...:|..:|:..:..::...|.|| ..
  Rat   130 ----PRSCASTDAQCLVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKKSYPGQITSNMFCLGFL 190

  Fly   206 SKNSGACYGDSGGPATYGGKVVGLASLLLGGGCG-RAAPDGYLRISKVRAWIAE 258
            .....:|.||||||....|::.|:.|  .|..|. |..|..|.::....:||.|
  Rat   191 EGGKDSCDGDSGGPVVCNGEIQGIVS--WGSVCAMRGKPGVYTKVCNYLSWIQE 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 62/229 (27%)
Tryp_SPc 37..219 CDD:238113 52/190 (27%)
LOC286960NP_775423.1 Tryp_SPc 23..240 CDD:214473 62/229 (27%)
Tryp_SPc 24..243 CDD:238113 65/232 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.