DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Tpsg1

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_006524421.1 Gene:Tpsg1 / 26945 MGIID:1349391 Length:368 Species:Mus musculus


Alignment Length:251 Identity:72/251 - (28%)
Similarity:109/251 - (43%) Gaps:52/251 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLL 100
            |||||..|..|.:|.|.||||...|.|||.::|...|:||.||.               :||:..
Mouse    86 RIVGGHAAPAGTWPWQASLRLHKVHVCGGSLLSPEWVLTAAHCF---------------SGSVNS 135

  Fly   101 SSDGVRIPVAEVIMHPNYAT--------------GGHNDLAVLRLQSPLTFDANIAAIQL--ATE 149
            |...|.:....|.:.|:::|              |...|:|:::|.||:...:.:..:.|  |:.
Mouse   136 SDYQVHLGELTVTLSPHFSTVKRIIMYTGSPGPPGSSGDIALVQLSSPVALSSQVQPVCLPEASA 200

  Fly   150 DPPNCVAVDISGWGNIAEKGPLSD--SLLFVQVTSISRGACRWMFY----SRLPETMICLLHSKN 208
            |....:...::|||...|..||..  :|...:|:.:....|...:.    |.:...|:|   ::.
Mouse   201 DFYPGMQCWVTGWGYTGEGEPLKPPYNLQEAKVSVVDVKTCSQAYNSPNGSLIQPDMLC---ARG 262

  Fly   209 SG-ACYGDSGGP------ATYGGKVVGLASLLLGGGCGRA-APDGYLRISKVRAWI 256
            .| ||..|||||      .|:  :..|:.|  .|.||||. .|..|.|::....||
Mouse   263 PGDACQDDSGGPLVCQVAGTW--QQAGVVS--WGEGCGRPDRPGVYARVTAYVNWI 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 70/249 (28%)
Tryp_SPc 37..219 CDD:238113 56/204 (27%)
Tpsg1XP_006524421.1 Tryp_SPc 87..317 CDD:238113 71/250 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842939
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.