DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Tmprss5

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_695223.2 Gene:Tmprss5 / 266681 RGDID:628625 Length:445 Species:Rattus norvegicus


Alignment Length:257 Identity:75/257 - (29%)
Similarity:122/257 - (47%) Gaps:28/257 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GQDVAQNQSESAIEP---RIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVKHG 82
            |:.|:...||....|   |||||.....|::|.|.|:.|...|.||..:::...|:||.||: :.
  Rat   189 GRIVSLKCSECGARPLASRIVGGQAVASGRWPWQASVMLGSRHTCGASVLAPYWVVTAAHCM-YS 252

  Fly    83 NDVVPADLWSIQAGSLLLSSDGVR----IPVAEVIMHPNYATGGHN-DLAVLRLQSPLTFDANIA 142
            ..:.....|.:.||  |:|...||    ..|.::|.||.|:...|: |:|:|:|::|:.|...::
  Rat   253 FRLSRLSSWRVHAG--LVSHSAVRQHQGTMVEKIIPHPLYSAQNHDYDVALLQLRTPINFSDTVS 315

  Fly   143 AIQLATEDP--PNCVAVDISGWG-----NIAEKGPLSDSLLFVQVTSISRGACRWMFYSRLPETM 200
            |:.|..::.  |......:||||     :......|.|:::.:..|.:...:|  |:...|...|
  Rat   316 AVCLPAKEQHFPQGSQCWVSGWGHTDPSHTHSSDTLQDTMVPLLSTDLCNSSC--MYSGALTHRM 378

  Fly   201 ICLLH-SKNSGACYGDSGGPATYGG----KVVGLASLLLGGGCGRA-APDGYLRISKVRAWI 256
            :|..: ...:.||.||||||.....    .:||:.|  .|.||... .|..|.::::...||
  Rat   379 LCAGYLDGRADACQGDSGGPLVCPSGDTWHLVGVVS--WGRGCAEPNRPGVYAKVAEFLDWI 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 68/237 (29%)
Tryp_SPc 37..219 CDD:238113 57/194 (29%)
Tmprss5NP_695223.2 SRCR_2 106..203 CDD:406055 4/13 (31%)
Tryp_SPc 208..441 CDD:238113 69/238 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.