DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and TPSG1

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_011520748.1 Gene:TPSG1 / 25823 HGNCID:14134 Length:346 Species:Homo sapiens


Alignment Length:247 Identity:77/247 - (31%)
Similarity:107/247 - (43%) Gaps:44/247 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLL 100
            |||||..|..|.:|.|.|||||..|.|||.::|...|:||.||.               :|||..
Human    62 RIVGGHAAPAGAWPWQASLRLRRVHVCGGSLLSPQWVLTAAHCF---------------SGSLNS 111

  Fly   101 SSDGVRIPVAEVIMHPNYAT--------------GGHNDLAVLRLQSPLTFDANIAAIQLATEDP 151
            |...|.:...|:.:.|:::|              |...|:|::.|..|:|..:.|..:.|.....
Human   112 SDYQVHLGELEITLSPHFSTVRQIILHSSPSGQPGTSGDIALVELSVPVTLSSRILPVCLPEASD 176

  Fly   152 PNCVAVD--ISGWGNIAEKGPLSD--SLLFVQVTSISRGACRWMF----YSRLPETMICLLHSKN 208
            ..|..:.  ::|||...|..||..  ||..|:|:.:....||..:    .|.|...|:|   ::.
Human   177 DFCPGIRCWVTGWGYTREGEPLPPPYSLREVKVSVVDTETCRRDYPGPGGSILQPDMLC---ARG 238

  Fly   209 SG-ACYGDSGGP--ATYGGKVVGLASLLLGGGCGRA-APDGYLRISKVRAWI 256
            .| ||..|||||  ....|..|...::..|.||||. .|..|.|:.....||
Human   239 PGDACQDDSGGPLVCQVNGAWVQAGTVSWGEGCGRPNRPGVYTRVPAYVNWI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 75/245 (31%)
Tryp_SPc 37..219 CDD:238113 62/204 (30%)
TPSG1XP_011520748.1 Tryp_SPc 62..290 CDD:214473 75/245 (31%)
Tryp_SPc 63..293 CDD:238113 76/246 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152867
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.