DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Prss1

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_036767.1 Gene:Prss1 / 24691 RGDID:3417 Length:246 Species:Rattus norvegicus


Alignment Length:269 Identity:82/269 - (30%)
Similarity:124/269 - (46%) Gaps:49/269 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLLLLLCGVQVILG-QDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATH 71
            :|:|.|.|..|... :|          :.:||||....:...|:|:||. .|.|:|||.:|:...
  Rat     4 LLILALVGAAVAFPLED----------DDKIVGGYTCPEHSVPYQVSLN-SGYHFCGGSLINDQW 57

  Fly    72 VITAGHCVK---------HGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYATGG-HNDL 126
            |::|.||.|         |..:|:..|...|.|              |::|.||||::.. :||:
  Rat    58 VVSAAHCYKSRIQVRLGEHNINVLEGDEQFINA--------------AKIIKHPNYSSWTLNNDI 108

  Fly   127 AVLRLQSPLTFDANIAAIQLATEDPPNCVAVDISGWGNIAEKGPLSDSLL-FVQVTSISRGACRW 190
            .:::|.||:..:|.:|.:.|.:...|......||||||....|..:..|| .|....:|:..|..
  Rat   109 MLIKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEA 173

  Fly   191 MFYSRLPETMIC---LLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGCGRAAPDG---YLRI 249
            .:...:..:|||   |...|:|  |.||||||....|::.|:.|  .|.||  |.||.   |.::
  Rat   174 AYPGEITSSMICVGFLEGGKDS--CQGDSGGPVVCNGQLQGIVS--WGYGC--ALPDNPGVYTKV 232

  Fly   250 SKVRAWIAE 258
            .....||.:
  Rat   233 CNFVGWIQD 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 74/236 (31%)
Tryp_SPc 37..219 CDD:238113 62/195 (32%)
Prss1NP_036767.1 Tryp_SPc 23..239 CDD:214473 74/236 (31%)
Tryp_SPc 24..242 CDD:238113 76/239 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.