DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG30289

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster


Alignment Length:267 Identity:70/267 - (26%)
Similarity:109/267 - (40%) Gaps:33/267 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVI 73
            ||:..||:           ..:....|.|.||.|....:.|..:  .:.....|||.:|:...|:
  Fly    25 LLVENCGI-----------SKDDPYVPNIFGGAKTNIQENPWMV--LVWSSKPCGGSLIARQFVL 76

  Fly    74 TAGHCVKHGNDVVP-ADLWSIQAGSLLLSSDGV----RIPVAEVIMHPNYATGG---HNDLAVLR 130
            ||.|||...:..|. .|..::......|::..:    .|.|...|:|.||  .|   .||:|:||
  Fly    77 TAAHCVSFEDLYVRLGDYETLDPMPYCLNNHCIPKFYNISVDMKIVHENY--NGITLQNDIALLR 139

  Fly   131 LQSPLTFDANIAAIQLATEDPPNCVAV-DISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMFYS 194
            :...:.:...:..|.|...:....:.: .::|||. .|.|..|..||...:.::....|...|..
  Fly   140 MSEAVEYSDYVRPICLLVGEQMQSIPMFTVTGWGE-TEYGQFSRILLNATLYNMDISYCNIKFNK 203

  Fly   195 RLPETMICLLHSKNSGACYGDSGGPAT----YGGKVVGLASLLLGGGCGRAAPD---GYLRISKV 252
            :...:.|| ..|..|..|.||||||.:    ||.:::.....|:..|..|.|.:   .|..:|..
  Fly   204 QADRSQIC-AGSHTSNTCKGDSGGPLSSKFHYGNRLLSFQYGLVSYGSERCAANVAGVYTNVSYH 267

  Fly   253 RAWIAEK 259
            |.||..|
  Fly   268 REWIFNK 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 62/235 (26%)
Tryp_SPc 37..219 CDD:238113 51/190 (27%)
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:214473 62/234 (26%)
Tryp_SPc 42..271 CDD:238113 62/234 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.