DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG30098

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster


Alignment Length:246 Identity:60/246 - (24%)
Similarity:105/246 - (42%) Gaps:51/246 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIVGGIKAKQGQFPHQISLRLRGEHY-CGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLL 99
            |::||..|::..:   ::..:|...: |||.:|:...|:||.||.|. ||.:...|....:..  
  Fly    36 RVIGGQNARRTPW---MAYLIRDNRFACGGSLIAYRFVLTAAHCTKI-NDNLFVRLGEYDSSR-- 94

  Fly   100 LSSDGV--RIPVAEVIMHPNYATGGHNDLAVLRLQSPLTFDANIAAIQLATEDPPNCVAVD---- 158
             ::||.  ...|..:..|.||....::|:|||:|...:.:||.|.         |.|:.::    
  Fly    95 -TTDGQTRSYRVVSIYRHKNYIDFRNHDIAVLKLDRQVVYDAYIR---------PICILLNSGLQ 149

  Fly   159 ----------ISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMFYSRLPETMICLLHSKNSGACY 213
                      ::|||.:|....:..:|..:.:..:....|      .:|...||..:.... ||:
  Fly   150 SLANSIQNFTLTGWGQMAHYYKMPTTLQEMSLRRVRNEYC------GVPSLSICCWNPVQY-ACF 207

  Fly   214 GDSGGP----ATYGGKVV----GLASLLLGGGCGRAAPDGYLRISKVRAWI 256
            ||||||    ..||.|.:    |:.:.:.|...|.::   ||.:.....|:
  Fly   208 GDSGGPLGSLVKYGHKTIYVQFGVTNSVTGNCDGYSS---YLDLMSYMPWL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 59/244 (24%)
Tryp_SPc 37..219 CDD:238113 48/198 (24%)
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 59/243 (24%)
Tryp_SPc 37..258 CDD:238113 59/245 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.