DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG30087

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:258 Identity:64/258 - (24%)
Similarity:103/258 - (39%) Gaps:30/258 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGH 77
            ||||..         :|::|:  |:|.|.:|.....|..:.:......:|||.|:::.:::||.|
  Fly    29 LCGVTY---------ESQTAM--RVVNGKEAVIRSAPFMVYVTNNSLTHCGGSILNSRYILTAAH 82

  Fly    78 CV------KHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYATGGH-NDLAVLRLQSPL 135
            ||      :.|...:..|. ..|..:....|:  ...:.:.|.|..|....| ||:|:|:|...:
  Fly    83 CVFPNLRLRLGEHNIRTDP-DCQGSNCSPRSE--EYGIMKAITHRFYNAANHVNDIALLKLNRSI 144

  Fly   136 TFDANI--AAIQLATEDPPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMFYSRLPE 198
            .|:.:|  ..|.|.....|:.......|||...:.| ....|...::.:.....|...|::.:..
  Fly   145 NFNVHIQPICILLNPASAPSVATYQTFGWGETKKNG-FPHLLQTAELRAYDAAYCSRSFHAYMNG 208

  Fly   199 TMICLLHSKNSGACYGDSGGPATYGGKVVGLASLL-LG----GGCGRAAPDGYLRISKVRAWI 256
            ..||..|.:.. .|.||||||........|:...| ||    |.....:|..|..:.....||
  Fly   209 NQICAGHEERD-TCAGDSGGPLVTRVDFDGVKRYLQLGIVSYGPTDCQSPGVYTYVPNYINWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 56/233 (24%)
Tryp_SPc 37..219 CDD:238113 46/190 (24%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 56/233 (24%)
Tryp_SPc 42..272 CDD:238113 57/234 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.