DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Prss42

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_694739.1 Gene:Prss42 / 235628 MGIID:2665280 Length:335 Species:Mus musculus


Alignment Length:242 Identity:68/242 - (28%)
Similarity:117/242 - (48%) Gaps:30/242 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAG--SL 98
            :|:||:.|::|::|.|:|:|:|..|.|||.:|::..|:||.||      :.....::::.|  |:
Mouse    78 KIMGGVDAEEGKWPWQVSVRVRHMHVCGGSLINSQWVLTAAHC------IYSRIQYNVKVGDRSV 136

  Fly    99 LLSSDGVRIPVAEVIMHPNYATG--GHNDLAVLRLQSPLTFDANIAAIQLATEDPP-----NCVA 156
            ...:..:.||:..:.:||.::|.  ..||:|:|:||.|:.|..||..:.:.:|..|     .|. 
Mouse   137 YRQNTSLVIPIKTIFVHPKFSTTIVVKNDIALLKLQHPVNFTTNIYPVCIPSESFPVKAGTKCW- 200

  Fly   157 VDISGWGNIAEKGP--LSDSLLFVQVTSISRGACRWMFYSRLPET-------MICLLHSKNSGAC 212
              ::|||.:....|  .::.|..|....|....|..|.......:       |:|....:...||
Mouse   201 --VTGWGKLVPGAPDVPTEILQEVDQNVILYEECNEMLKKATSSSVDLVKRGMVCGYKERGKDAC 263

  Fly   213 YGDSGGPAT--YGGKVVGLASLLLGGGCGRAA-PDGYLRISKVRAWI 256
            .||||||.:  :..|.|.:..:..|..|||.. |..|..::....|:
Mouse   264 QGDSGGPMSCEFENKWVQVGVVSWGISCGRKGYPGVYTDVAFYSKWL 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 67/240 (28%)
Tryp_SPc 37..219 CDD:238113 57/199 (29%)
Prss42NP_694739.1 Tryp_SPc 78..309 CDD:214473 67/239 (28%)
Tryp_SPc 79..310 CDD:238113 67/239 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.