DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and TPSD1

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_036349.1 Gene:TPSD1 / 23430 HGNCID:14118 Length:242 Species:Homo sapiens


Alignment Length:236 Identity:70/236 - (29%)
Similarity:116/236 - (49%) Gaps:33/236 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLLLLLCGVQVILGQD-VAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGE---HYCGGVIIS 68
            :|.|||..:.|:.... ||....::..:..||||.:|.:.::|.|:|||:||.   |:|||.:|.
Human     8 MLSLLLLALPVLASPAYVAPAPGQALQQTGIVGGQEAPRSKWPWQVSLRVRGPYWMHFCGGSLIH 72

  Fly    69 ATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNY---ATGGHNDLAVLR 130
            ...|:||.|||:  .|:.......:|.....|......:||:.:|:||.:   .||.  |:|:|.
Human    73 PQWVLTAAHCVE--PDIKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYIIQTGA--DIALLE 133

  Fly   131 LQSPLTFDANIAAIQL--ATEDPPNCVAVDISGWGNIAEK------GPLSDSLLFVQVTSISRGA 187
            |:.|:...::|..:.|  |:|..|..:...::|||::...      .||.:    |:|..:....
Human   134 LEEPVNISSHIHTVTLPPASETFPPGMPCWVTGWGDVDNNVHLPPPYPLKE----VEVPVVENHL 194

  Fly   188 CRWMFYSRL---------PETMICLLHSKNSGACYGDSGGP 219
            |...:::.|         .:.|:| ..|:|..:|.||||||
Human   195 CNAEYHTGLHTGHSFQIVRDDMLC-AGSENHDSCQGDSGGP 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 63/207 (30%)
Tryp_SPc 37..219 CDD:238113 61/204 (30%)
TPSD1NP_036349.1 Tryp_SPc 38..242 CDD:238113 63/206 (31%)
Tryp_SPc 38..240 CDD:214473 63/206 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152915
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7244
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.790

Return to query results.
Submit another query.