DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Tmprss11d

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_663536.1 Gene:Tmprss11d / 231382 MGIID:2385221 Length:417 Species:Mus musculus


Alignment Length:243 Identity:82/243 - (33%)
Similarity:122/243 - (50%) Gaps:22/243 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVK-HGNDVVPADLWSIQAGS 97
            |.||:||::|:.|.:|.|:||:|...|:|||.:||...|:||.||.| :.|    ...|:...| 
Mouse   183 EERIIGGMQAEPGDWPWQVSLQLNNVHHCGGALISNMWVLTAAHCFKSYPN----PQYWTATFG- 242

  Fly    98 LLLSSDGVRIPVAEVIMHPNYAT-GGHNDLAVLRLQSPLTFDANIAAIQL--ATED-PPNCVAVD 158
            :...|..:|:.|..::.|..|:: ...||:||::|...:.|..||..:.|  ||:: .|..||. 
Mouse   243 VSTMSPRLRVRVRAILAHDGYSSVTRDNDIAVVQLDRSVAFSRNIHRVCLPAATQNIIPGSVAY- 306

  Fly   159 ISGWGNIAEKGPLSDSLLFVQVTSISRGACRW-MFYSR--LPETMICLLHSKNSGACYGDSGGPA 220
            ::|||::...|....:|...:|..||...|.. ..||.  ||..:...:.|....||.||||||.
Mouse   307 VTGWGSLTYGGNAVTNLRQGEVRIISSEECNTPAGYSGSVLPGMLCAGMRSGAVDACQGDSGGPL 371

  Fly   221 TYGGK-----VVGLASLLLGGGCGRA-APDGYLRISKVRAWIAEKAGL 262
            .....     |||:.|  .|..||.. .|..|.|::..|.||.::.|:
Mouse   372 VQEDSRRLWFVVGIVS--WGYQCGLPNKPGVYTRVTAYRNWIRQQTGI 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 78/233 (33%)
Tryp_SPc 37..219 CDD:238113 64/189 (34%)
Tmprss11dNP_663536.1 SEA 48..140 CDD:279699
Tryp_SPc 185..411 CDD:214473 78/233 (33%)
Tryp_SPc 186..414 CDD:238113 79/235 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.