DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Prss38

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001038986.1 Gene:Prss38 / 216797 MGIID:2685095 Length:322 Species:Mus musculus


Alignment Length:258 Identity:76/258 - (29%)
Similarity:120/258 - (46%) Gaps:35/258 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVKHGND 84
            |..|||..|  ..::.:::||..|:..::|.|:||...|.|.|||.|:||..|::|.||...|..
Mouse    41 LSGDVACGQ--PVLQGKLLGGEFARDRKWPWQVSLHYSGFHICGGSILSAYWVLSAAHCFDRGKK 103

  Fly    85 VVPADLWSIQAGSLLLSSDGVR---IPVAEVIMHPNY----ATGGHNDLAVLRLQSPLTFDANIA 142
            :   :.:.|..|...|......   ..:.:||:||.:    ..||  |:|:::|:|.:.|...:.
Mouse   104 L---ETYDIYVGITNLEKANRHTQWFEIYQVIIHPTFQMYHPIGG--DVALVQLKSAIVFSDFVL 163

  Fly   143 AIQLATEDPPNCVAVDIS----GWGNIAEKGPLSDSLLFVQVTSISRGACRWMF----YSRLPET 199
            .|.|   .|.:...:::|    |||.|:.:|...:.||..|:..|.|..|:.::    | .||| 
Mouse   164 PICL---PPSDLYLINLSCWTTGWGMISPQGETGNELLEAQLPLIPRFQCQLLYGLSSY-LLPE- 223

  Fly   200 MICLLHSKN-SGACYGDSGGPATYGGK----VVGLASLLLGGGCGRAA-PDGYLRISKVRAWI 256
            |:|....|. ...|.||||.|......    .:|:.|  .|.||.:.. |..:..:|...:||
Mouse   224 MLCAADIKTMKNVCEGDSGSPLVCKQNQTWLQIGIVS--WGRGCAQPLYPGVFANVSYFLSWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 69/240 (29%)
Tryp_SPc 37..219 CDD:238113 61/197 (31%)
Prss38NP_001038986.1 Tryp_SPc 58..287 CDD:238113 71/239 (30%)
Tryp_SPc 58..284 CDD:214473 69/237 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.