DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and F11

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_005262878.1 Gene:F11 / 2160 HGNCID:3529 Length:626 Species:Homo sapiens


Alignment Length:258 Identity:68/258 - (26%)
Similarity:120/258 - (46%) Gaps:39/258 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NQSESAIEPRIVGGIKAKQGQFPHQISLRLRG---EHYCGGVIISATHVITAGHCVKHGNDVVPA 88
            |:..:.|:||||||..:.:|::|.|::|....   .|.|||.||....::||.||          
Human   379 NECTTKIKPRIVGGTASVRGEWPWQVTLHTTSPTQRHLCGGSIIGNQWILTAAHC---------- 433

  Fly    89 DLWSIQAGSLL-----------LSSDGVRIPVAEVIMHPNY--ATGGHNDLAVLRLQSPLTFDAN 140
             .:.:::..:|           :..|.....|.|:|:|..|  |..|: |:|:|:|::.:.:..:
Human   434 -FYGVESPKILRVYSGILNQSEIKEDTSFFGVQEIIIHDQYKMAESGY-DIALLKLETTVNYTDS 496

  Fly   141 IAAIQLATEDPPNCVAVD--ISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMFYS-RLPETMIC 202
            ...|.|.::...|.:..|  ::|||....:..:.::|...::..::...|:..:.. ::...|||
Human   497 QRPICLPSKGDRNVIYTDCWVTGWGYRKLRDKIQNTLQKAKIPLVTNEECQKRYRGHKITHKMIC 561

  Fly   203 LLHSK-NSGACYGDSGGPATYGGK----VVGLASLLLGGGCG-RAAPDGYLRISKVRAWIAEK 259
            ..:.: ...||.||||||.:....    :||:.|  .|.||. |..|..|..:.:...||.||
Human   562 AGYREGGKDACKGDSGGPLSCKHNEVWHLVGITS--WGEGCAQRERPGVYTNVVEYVDWILEK 622

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 61/244 (25%)
Tryp_SPc 37..219 CDD:238113 49/201 (24%)
F11XP_005262878.1 APPLE 20..103 CDD:128519
APPLE 110..193 CDD:128519
APPLE 200..283 CDD:128519
APPLE 291..375 CDD:128519
Tryp_SPc 388..619 CDD:214473 61/244 (25%)
Tryp_SPc 389..619 CDD:238113 60/243 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.