DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Tmprss4

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_663378.1 Gene:Tmprss4 / 214523 MGIID:2384877 Length:435 Species:Mus musculus


Alignment Length:259 Identity:83/259 - (32%)
Similarity:121/259 - (46%) Gaps:34/259 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QNQSESAIE-----------------PRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVI 73
            ||.|.|.:.                 ||:|||::|....:|.|:|::...:|.|||.|:....::
Mouse   175 QNGSRSCLSGSLVSLRCLDCGKSLKTPRVVGGVEAPVDSWPWQVSIQYNKQHVCGGSILDPHWIL 239

  Fly    74 TAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEV-IMHPNYATGGHNDLAVLRLQSPLTF 137
            ||.||.:...||   ..|.::|||.:| .:...:|||:: |..||.......|:|:::||.||||
Mouse   240 TAAHCFRKYLDV---SSWKVRAGSNIL-GNSPSLPVAKIFIAEPNPLYPKEKDIALVKLQMPLTF 300

  Fly   138 DANIAAIQLATEDPPNCVA--VDISGWGNIAEK-GPLSDSLL--FVQVTSISRGACRWMFYSRLP 197
            ..::..|.|...|.....|  |.:.|||...|. |.:||.||  .|||...:|......:...:.
Mouse   301 SGSVRPICLPFSDEVLVPATPVWVIGWGFTEENGGKMSDMLLQASVQVIDSTRCNAEDAYEGEVT 365

  Fly   198 ETMICL-LHSKNSGACYGDSGGPATYGG---KVVGLASLLLGGGC-GRAAPDGYLRISKVRAWI 256
            ..|:|. ........|.||||||..|..   :|||:.|  .|.|| |.:.|..|.:::....||
Mouse   366 AEMLCAGTPQGGKDTCQGDSGGPLMYHSDKWQVVGIVS--WGHGCGGPSTPGVYTKVTAYLNWI 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 76/230 (33%)
Tryp_SPc 37..219 CDD:238113 62/188 (33%)
Tmprss4NP_663378.1 LDLa 56..90 CDD:238060
SRCR_2 106..195 CDD:295335 4/19 (21%)
Tryp_SPc 202..427 CDD:214473 76/230 (33%)
Tryp_SPc 203..430 CDD:238113 77/231 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.