DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Tmprss7

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_766043.3 Gene:Tmprss7 / 208171 MGIID:2686594 Length:829 Species:Mus musculus


Alignment Length:291 Identity:82/291 - (28%)
Similarity:119/291 - (40%) Gaps:69/291 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 CGVQVILGQDVAQ------------------NQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEH 60
            ||..:...:..||                  ::|.|.:. |||||..:::|.:|.|:||...|..
Mouse   552 CGNDICFRKQNAQCDGIVDCPDGSDEEGCGCSRSSSFLH-RIVGGSDSQEGTWPWQVSLHFVGSA 615

  Fly    61 YCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYATGGHND 125
            |||..:||...:::|.||. |||.:.....|:...|..:..:.....||..:::|..|       
Mouse   616 YCGASVISREWLLSAAHCF-HGNRLSDPTPWTAHLGMYVQGNAKFISPVRRIVVHEYY------- 672

  Fly   126 LAVLRLQSPLTFDANIAAIQLATEDP--------PNCVAVD-----------ISGWGNIAE---K 168
                   :..|||.:||.:||:...|        |.|:...           ::|||...|   |
Mouse   673 -------NSQTFDYDIALLQLSIAWPETLKQLIQPICIPPAGQKVRSGEKCWVTGWGRRHEADSK 730

  Fly   169 GPLSDSLLFVQVTSISRGACRWMFYSRLPETMICL-LHSKNSGACYGDSGGPATYGGK------V 226
            |  |..|...:|..|.:..| ...|..:...|:|. :.|..|.||.||||||.:...|      :
Mouse   731 G--SPVLQQAEVELIDQTVC-VSTYGIITSRMLCAGVMSGKSDACKGDSGGPLSCRRKSDGKWIL 792

  Fly   227 VGLASLLLGGGCGRA-APDGYLRISKVRAWI 256
            .|:.|  .|.||||. .|..|.|:|....||
Mouse   793 TGIVS--WGHGCGRPNFPGVYTRVSSFVPWI 821

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 74/249 (30%)
Tryp_SPc 37..219 CDD:238113 59/204 (29%)
Tmprss7NP_766043.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..52
SEA 94..194 CDD:366610
CUB <257..345 CDD:238001
LDLa 470..504 CDD:238060
LDLa 545..580 CDD:238060 4/27 (15%)
Tryp_SPc 591..821 CDD:214473 74/249 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.